Recombinant Human DGAT2 protein, GST-tagged
Cat.No. : | DGAT2-27396TH |
Product Overview : | Recombinant Human DGAT2(1 a.a. - 388 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-388 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 70.2 kDa |
AA Sequence : | MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ] |
Official Symbol | DGAT2 |
Synonyms | DGAT2; diacylglycerol O-acyltransferase 2; diacylglycerol O acyltransferase homolog 2 (mouse); diglyceride acyltransferase 2; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; HMFN1045; GS1999FULL; DKFZp686A15125; |
Gene ID | 84649 |
mRNA Refseq | NM_001253891 |
Protein Refseq | NP_001240820 |
MIM | 606983 |
UniProt ID | Q96PD7 |
Chromosome Location | 11q13.3 |
Function | 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; transferase activity, transferring acyl groups other than amino-acyl groups; |
◆ Cell & Tissue Lysates | ||
DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGAT2 Products
Required fields are marked with *
My Review for All DGAT2 Products
Required fields are marked with *