Recombinant Human DGAT2 protein, GST-tagged
| Cat.No. : | DGAT2-27396TH | 
| Product Overview : | Recombinant Human DGAT2(1 a.a. - 388 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Protein Length : | 1-388 a.a. | 
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 70.2 kDa | 
| AA Sequence : | MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Gene Name | DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ] | 
| Official Symbol | DGAT2 | 
| Synonyms | DGAT2; diacylglycerol O-acyltransferase 2; diacylglycerol O acyltransferase homolog 2 (mouse); diglyceride acyltransferase 2; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; HMFN1045; GS1999FULL; DKFZp686A15125; | 
| Gene ID | 84649 | 
| mRNA Refseq | NM_001253891 | 
| Protein Refseq | NP_001240820 | 
| MIM | 606983 | 
| UniProt ID | Q96PD7 | 
| Chromosome Location | 11q13.3 | 
| Function | 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; transferase activity, transferring acyl groups other than amino-acyl groups; | 
| ◆ Recombinant Proteins | ||
| DGAT2-27396TH | Recombinant Human DGAT2 protein, GST-tagged | +Inquiry | 
| DGAT2-6838HF | Recombinant Full Length Human DGAT2 Protein, GST-tagged | +Inquiry | 
| DGAT2-1511R | Recombinant Rat DGAT2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| DGAT2-27397H | Recombinant Human DGAT2, GST-tagged | +Inquiry | 
| RFL11813XF | Recombinant Full Length Xenopus Tropicalis Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGAT2 Products
Required fields are marked with *
My Review for All DGAT2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            