Recombinant Full Length Human DNAJC3 Protein
Cat.No. : | DNAJC3-124HF |
Product Overview : | Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 51.850kDa inclusive of tags |
Protein Length : | 234 amino acids |
AA Sequence : | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ] |
Official Symbol : | DNAJC3 |
Synonyms : | DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK |
Gene ID : | 5611 |
mRNA Refseq : | NM_006260 |
Protein Refseq : | NP_006251 |
MIM : | 601184 |
UniProt ID : | Q13217 |
Products Types
◆ Recombinant Protein | ||
DNAJC3-2387H | Recombinant Human DNAJC3 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC3-775H | Recombinant Human DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-2760H | Recombinant Human DNAJC3 Protein, GST-tagged | +Inquiry |
DNAJC3-1121R | Recombinant Rhesus Macaque DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-1571R | Recombinant Rat DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket