Recombinant Human DNAJC3

Cat.No. : DNAJC3-26638TH
Product Overview : Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 234 amino acids
Description : This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).
Molecular Weight : 51.850kDa inclusive of tags
Tissue specificity : Widely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Sequence Similarities : Contains 1 J domain.Contains 9 TPR repeats.
Gene Name DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
Official Symbol DNAJC3
Synonyms DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK;
Gene ID 5611
mRNA Refseq NM_006260
Protein Refseq NP_006251
MIM 601184
Uniprot ID Q13217
Chromosome Location 13q32
Pathway Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Influenza Infection, organism-specific biosystem;
Function binding; chaperone binding; heat shock protein binding; misfolded protein binding; protein kinase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC3 Products

Required fields are marked with *

My Review for All DNAJC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon