Recombinant Full Length Human EFNA2 Protein
| Cat.No. : | EFNA2-137HF |
| Product Overview : | Recombinant full length Human Ephrin A2 with N-terminal proprietary tag. Predicted MW 50.43kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 213 amino acids |
| Description : | This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
| Form : | Liquid |
| Molecular Mass : | 50.430kDa inclusive of tags |
| AA Sequence : | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | EFNA2 ephrin-A2 [ Homo sapiens ] |
| Official Symbol | EFNA2 |
| Synonyms | EFNA2; ephrin-A2; EPLG6; ELF1; LERK6 |
| Gene ID | 1943 |
| mRNA Refseq | NM_001405 |
| Protein Refseq | NP_001396 |
| MIM | 602756 |
| UniProt ID | O43921 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA2 Products
Required fields are marked with *
My Review for All EFNA2 Products
Required fields are marked with *




