Recombinant Full Length Human EFNA2 Protein

Species :	Human
Source :	In Vitro Cell Free System
Protein Length :	213 amino acids
Description :	This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Form :	Liquid
Molecular Mass :	50.430kDa inclusive of tags
AA Sequence :	MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
Purity :	Proprietary Purification
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer :	pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.