| Species : |
Human |
| Source : |
In Vitro Cell Free System |
| Protein Length : |
213 amino acids |
| Description : |
This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
| Form : |
Liquid |
| Molecular Mass : |
50.430kDa inclusive of tags |
| AA Sequence : |
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |