Recombinant Full Length Human EFNA2 Protein
Cat.No. : | EFNA2-137HF |
Product Overview : | Recombinant full length Human Ephrin A2 with N-terminal proprietary tag. Predicted MW 50.43kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 50.430kDa inclusive of tags |
Protein Length : | 213 amino acids |
AA Sequence : | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | EFNA2 ephrin-A2 [ Homo sapiens ] |
Official Symbol : | EFNA2 |
Synonyms : | EFNA2; ephrin-A2; EPLG6; ELF1; LERK6 |
Gene ID : | 1943 |
mRNA Refseq : | NM_001405 |
Protein Refseq : | NP_001396 |
MIM : | 602756 |
UniProt ID : | O43921 |
Products Types
◆ Recombinant Protein | ||
Efna2-2754M | Recombinant Mouse Efna2 Protein, Myc/DDK-tagged | +Inquiry |
EFNA2-52H | Recombinant Human EFNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Efna2-2669M | Recombinant Mouse Efna2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFNA2-1381H | Recombinant Human EFNA2 Protein, MYC/DDK-tagged | +Inquiry |
EFNA2-1407H | Recombinant Human EFNA2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
EFNA2-2004MCL | Recombinant Mouse EFNA2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket