Recombinant Full Length Human EFNA2 Protein

Cat.No. : EFNA2-137HF
Product Overview : Recombinant full length Human Ephrin A2 with N-terminal proprietary tag. Predicted MW 50.43kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 213 amino acids
Description : This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Form : Liquid
Molecular Mass : 50.430kDa inclusive of tags
AA Sequence : MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name EFNA2 ephrin-A2 [ Homo sapiens ]
Official Symbol EFNA2
Synonyms EFNA2; ephrin-A2; EPLG6; ELF1; LERK6
Gene ID 1943
mRNA Refseq NM_001405
Protein Refseq NP_001396
MIM 602756
UniProt ID O43921

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA2 Products

Required fields are marked with *

My Review for All EFNA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon