Recombinant Full Length Human FKBP9L Protein, GST-tagged

Cat.No. : FKBP9L-4821HF
Product Overview : Human FKBP9L full-length ORF ( NP_878247.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 142 amino acids
Description : FKBP9P1 (FK506 Binding Protein 9 Pseudogene 1) is a Pseudogene.
Molecular Mass : 42 kDa
AA Sequence : MDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKQDEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP9P1 FKBP prolyl isomerase 9 pseudogene 1 [ Homo sapiens (human) ]
Official Symbol FKBP9L
Synonyms FKBP9P1; FK506 binding protein 9 pseudogene 1; FKBP9L; FK506 binding protein 9-like; MGC20531
Gene ID 360132
UniProt ID Q75LS8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP9L Products

Required fields are marked with *

My Review for All FKBP9L Products

Required fields are marked with *

0
cart-icon