Recombinant Full Length Human HMGB2 Protein, C-Flag-tagged
Cat.No. : | HMGB2-2002HFL |
Product Overview : | Recombinant Full Length Human HMGB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | HMGB2 high mobility group box 2 [ Homo sapiens (human) ] |
Official Symbol | HMGB2 |
Synonyms | HMG2 |
Gene ID | 3148 |
mRNA Refseq | NM_002129.4 |
Protein Refseq | NP_002120.1 |
MIM | 163906 |
UniProt ID | P26583 |
◆ Recombinant Proteins | ||
HMGB2-711H | Recombinant Human HMGB2 Protein, His-tagged | +Inquiry |
HMGB2-2738H | Recombinant Human HMGB2 Protein (Gly2-Glu209), C-His tagged | +Inquiry |
HMGB2-7729M | Recombinant Mouse HMGB2 Protein | +Inquiry |
HMGB2-2703H | Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged | +Inquiry |
HMGB2-177H | Recombinant Human HMGB2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB2-5477HCL | Recombinant Human HMGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB2 Products
Required fields are marked with *
My Review for All HMGB2 Products
Required fields are marked with *
0
Inquiry Basket