Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged

Cat.No. : HMGB2-2703H
Product Overview : Recombinant Human HMGB2 protein(P26583)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 101-190 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDE
Gene Name HMGB2 high mobility group box 2 [ Homo sapiens ]
Official Symbol HMGB2
Synonyms HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2;
Gene ID 3148
mRNA Refseq NM_001130688
Protein Refseq NP_001124160
MIM 163906
UniProt ID P26583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGB2 Products

Required fields are marked with *

My Review for All HMGB2 Products

Required fields are marked with *

0
cart-icon