Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged
Cat.No. : | HMGB2-2703H |
Product Overview : | Recombinant Human HMGB2 protein(P26583)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-190 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDE |
Gene Name | HMGB2 high mobility group box 2 [ Homo sapiens ] |
Official Symbol | HMGB2 |
Synonyms | HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2; |
Gene ID | 3148 |
mRNA Refseq | NM_001130688 |
Protein Refseq | NP_001124160 |
MIM | 163906 |
UniProt ID | P26583 |
◆ Recombinant Proteins | ||
HMGB2-7035C | Recombinant Chicken HMGB2 | +Inquiry |
HMGB2-3598H | Recombinant Human HMGB2 protein, His-tagged | +Inquiry |
HMGB2-3644HF | Recombinant Full Length Human HMGB2 Protein, GST-tagged | +Inquiry |
HMGB2-2739H | Recombinant Human HMGB2 Protein (Gly2-Pro187), His tagged | +Inquiry |
HMGB2-2738H | Recombinant Human HMGB2 Protein (Gly2-Glu209), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB2-5477HCL | Recombinant Human HMGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB2 Products
Required fields are marked with *
My Review for All HMGB2 Products
Required fields are marked with *
0
Inquiry Basket