Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged
| Cat.No. : | HMGB2-2703H |
| Product Overview : | Recombinant Human HMGB2 protein(P26583)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-190 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDE |
| Gene Name | HMGB2 high mobility group box 2 [ Homo sapiens ] |
| Official Symbol | HMGB2 |
| Synonyms | HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2; |
| Gene ID | 3148 |
| mRNA Refseq | NM_001130688 |
| Protein Refseq | NP_001124160 |
| MIM | 163906 |
| UniProt ID | P26583 |
| ◆ Recombinant Proteins | ||
| HMGB2-2703H | Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged | +Inquiry |
| HMGB2-13842H | Recombinant Human HMGB2, GST-tagged | +Inquiry |
| Hmgb2-1626R | Recombinant Rat Hmgb2 Protein, His-tagged | +Inquiry |
| HMGB2-4868H | Recombinant Human HMGB2 Protein, His-Flag-StrepII-tagged | +Inquiry |
| HMGB2-7035C | Recombinant Chicken HMGB2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGB2-5477HCL | Recombinant Human HMGB2 293 Cell Lysate | +Inquiry |
| HMGB2-484HKCL | Human HMGB2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB2 Products
Required fields are marked with *
My Review for All HMGB2 Products
Required fields are marked with *
