Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged

• Cat.No.: HMGB2-2703H
• Product Overview: Recombinant Human HMGB2 protein(P26583)(101-190 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 101-190 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDE

Gene Information

• Gene Name: HMGB2 high mobility group box 2 [ Homo sapiens ]
• Official Symbol: HMGB2
• Synonyms: HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2
• Gene ID: 3148
• mRNA Refseq: NM_001130688
• Protein Refseq: NP_001124160
• MIM: 163906
• UniProt ID: P26583