Recombinant Full Length Human PAK4 Protein, C-Flag-tagged
Cat.No. : | PAK4-382HFL |
Product Overview : | Recombinant Full Length Human PAK4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.9 kDa |
AA Sequence : | MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKTI VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAG HSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPR ADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA PAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRL PYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQR ATAAELLKHPFLAKAGPPASIVPLMRQNRTRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway |
Full Length : | Full L. |
Gene Name | PAK4 p21 (RAC1) activated kinase 4 [ Homo sapiens (human) ] |
Official Symbol | PAK4 |
Synonyms | p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A)-activated kinase 4; p21-activated kinase 4 |
Gene ID | 10298 |
mRNA Refseq | NM_005884.5 |
Protein Refseq | NP_005875.1 |
MIM | 605451 |
UniProt ID | O96013 |
◆ Recombinant Proteins | ||
PAK4-1966H | Recombinant Human PAK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAK4-105H | Recombinant Human P21 Protein-activated Kinase 4, His-tagged | +Inquiry |
PAK4-380H | Recombinant Human PAK4, GST-tagged, Active | +Inquiry |
PAK4-766H | Recombinant Human PAK4 Protein, His-tagged | +Inquiry |
PAK4-3407HF | Active Recombinant Full Length Human PAK4 Protein, DDK-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK4-3456HCL | Recombinant Human PAK4 293 Cell Lysate | +Inquiry |
PAK4-3455HCL | Recombinant Human PAK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAK4 Products
Required fields are marked with *
My Review for All PAK4 Products
Required fields are marked with *
0
Inquiry Basket