Active Recombinant Human PAK4
Cat.No. : | PAK4-18H |
Product Overview : | PAK4KD is a recombinant wild type human PAK4 kinase domain (amino acids 300–591 of full-length human PAK4) expressed in E. coli and purified to homogeneity with full activity. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Human PAK4 kinase (UniProt: O96013; NCBI: NM_005884) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. |
Form : | 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT. |
Bio-activity : | 5,595 pmoles/min/μg |
Molecular Mass : | The calculated mass is 33,309. PAK4KD is fully phosphorylated at S474 with a measured mass of 33,389 (1P). |
AA Sequence : | GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSD SILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNE PPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT |
Applications : | Enzymatic studies, inhibitor screen, and selectivity profiling |
Storage : | Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC. |
Gene Name | PAK4 p21 protein (Cdc42/Rac)-activated kinase 4 [ Homo sapiens ] |
Official Symbol | PAK4 |
Synonyms | PAK4; p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A) activated kinase 4; serine/threonine-protein kinase PAK 4; PAK-4; p21-activated kinase 4; p21(CDKN1A)-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs; |
Gene ID | 10298 |
mRNA Refseq | NM_001014831 |
Protein Refseq | NP_001014831 |
MIM | 605451 |
UniProt ID | O96013 |
Chromosome Location | 19p11-q11 |
Pathway | Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
PAK4-382HFL | Recombinant Full Length Human PAK4 Protein, C-Flag-tagged | +Inquiry |
Pak4-4663M | Recombinant Mouse Pak4 Protein, Myc/DDK-tagged | +Inquiry |
PAK4-1966H | Recombinant Human PAK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAK4-3888H | Recombinant Human PAK4 Protein (Val299-Ser542), His tagged | +Inquiry |
Pak4-1894M | Recombinant Mouse Pak4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK4-3456HCL | Recombinant Human PAK4 293 Cell Lysate | +Inquiry |
PAK4-3455HCL | Recombinant Human PAK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAK4 Products
Required fields are marked with *
My Review for All PAK4 Products
Required fields are marked with *