Recombinant Full Length Human TCEA3 Protein
Cat.No. : | TCEA3-520HF |
Product Overview : | Recombinant full length Human TFIISH with a N terminal proprietary tag; Predicted MWt 64.39 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 64.390kDa inclusive of tags |
Protein Length : | 348 amino acids |
AA Sequence : | MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSI QLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLD SPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKK REDPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPK TPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALK ADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRS RISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTY NQVQTRSADEPMTTFVLCNECGNRWKFC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | TCEA3 transcription elongation factor A (SII), 3 [ Homo sapiens ] |
Official Symbol : | TCEA3 |
Synonyms : | TCEA3; transcription elongation factor A (SII), 3; transcription elongation factor A protein 3; TFIIS.H |
Gene ID : | 6920 |
mRNA Refseq : | NM_003196 |
Protein Refseq : | NP_003187 |
MIM : | 604128 |
UniProt ID : | O75764 |
Products Types
◆ Recombinant Protein | ||
Tcea3-6329M | Recombinant Mouse Tcea3 Protein, Myc/DDK-tagged | +Inquiry |
TCEA3-9070M | Recombinant Mouse TCEA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tcea3-1682M | Recombinant Mouse Tcea3 protein, His & T7-tagged | +Inquiry |
TCEA3-3149H | Recombinant Human TCEA3, GST-tagged | +Inquiry |
TCEA3-16542M | Recombinant Mouse TCEA3 Protein | +Inquiry |
◆ Lysates | ||
TCEA3-1748HCL | Recombinant Human TCEA3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket