Recombinant Full Length Human TCEA3 Protein
Cat.No. : | TCEA3-520HF |
Product Overview : | Recombinant full length Human TFIISH with a N terminal proprietary tag; Predicted MWt 64.39 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 348 amino acids |
Description : | The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 64.390kDa inclusive of tags |
AA Sequence : | MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSI QLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLD SPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKK REDPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPK TPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALK ADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRS RISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTY NQVQTRSADEPMTTFVLCNECGNRWKFC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | TCEA3 transcription elongation factor A (SII), 3 [ Homo sapiens ] |
Official Symbol | TCEA3 |
Synonyms | TCEA3; transcription elongation factor A (SII), 3; transcription elongation factor A protein 3; TFIIS.H |
Gene ID | 6920 |
mRNA Refseq | NM_003196 |
Protein Refseq | NP_003187 |
MIM | 604128 |
UniProt ID | O75764 |
◆ Recombinant Proteins | ||
TCEA3-30320TH | Recombinant Human TCEA3 | +Inquiry |
TCEA3-11706Z | Recombinant Zebrafish TCEA3 | +Inquiry |
TCEA3-520HF | Recombinant Full Length Human TCEA3 Protein | +Inquiry |
Tcea3-6329M | Recombinant Mouse Tcea3 Protein, Myc/DDK-tagged | +Inquiry |
Tcea3-1682M | Recombinant Mouse Tcea3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEA3-1748HCL | Recombinant Human TCEA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCEA3 Products
Required fields are marked with *
My Review for All TCEA3 Products
Required fields are marked with *
0
Inquiry Basket