Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 8(Tnfrsf8) Protein, His-Tagged
Cat.No. : | RFL31646HF |
Product Overview : | Recombinant Full Length Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8) Protein (P28908) (19-595aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-595) |
Form : | Lyophilized powder |
AA Sequence : | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNFRSF8 |
Synonyms | TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30 |
UniProt ID | P28908 |
◆ Recombinant Proteins | ||
TNFRSF8-373H | Active Recombinant Human TNFRSF8 Protein, LIgG2b Fc-tagged, low endotoxin | +Inquiry |
TNFRSF8-444H | Recombinant Human TNFRSF8 protein, His-Avi-tagged | +Inquiry |
TNFRSF8-642HP | Recombinant Human TNFRSF8 protein, Fc-His-tagged, R-PE labeled | +Inquiry |
TNFRSF8-7532H | Recombinant Human TNFRSF8, His-tagged | +Inquiry |
TNFRSF8-641HP | Recombinant Human TNFRSF8 protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF8-2097HCL | Recombinant Human TNFRSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF8 Products
Required fields are marked with *
My Review for All TNFRSF8 Products
Required fields are marked with *
0
Inquiry Basket