Recombinant Full Length Human XIAP Protein, C-Flag-tagged
Cat.No. : | XIAP-1757HFL |
Product Overview : | Recombinant Full Length Human XIAP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to a family of apoptotic suppressor proteins. Members of this family share a conserved motif termed, baculovirus IAP repeat, which is necessary for their anti-apoptotic function. This protein functions through binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2 and inhibits apoptosis induced by menadione, a potent inducer of free radicals, and interleukin 1-beta converting enzyme. This protein also inhibits at least two members of the caspase family of cell-death proteases, caspase-3 and caspase-7. Mutations in this gene are the cause of X-linked lymphoproliferative syndrome. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 2 and 11. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.5 kDa |
AA Sequence : | MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAV DRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYL LRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNW EPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVN KEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITF KQKIFMSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | XIAP X-linked inhibitor of apoptosis [ Homo sapiens (human) ] |
Official Symbol | XIAP |
Synonyms | API3; ILP1; MIHA; XLP2; BIRC4; IAP-3; hIAP3; hIAP-3 |
Gene ID | 331 |
mRNA Refseq | NM_001167.4 |
Protein Refseq | NP_001158.2 |
MIM | 300079 |
UniProt ID | P98170 |
◆ Recombinant Proteins | ||
XIAP-245H | Recombinant Human XIAP Protein, GST/StrepII-tagged | +Inquiry |
XIAP-2873H | Recombinant Human Full length XIAP protein(1-497 aa), C-His-tagged | +Inquiry |
XIAP-0711H | Recombinant Human XIAP Protein (Y120-P260), Tag Free | +Inquiry |
XIAP-18605M | Recombinant Mouse XIAP Protein | +Inquiry |
XIAP-243H | Active Recombinant Human XIAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
XIAP-263HCL | Recombinant Human XIAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XIAP Products
Required fields are marked with *
My Review for All XIAP Products
Required fields are marked with *
0
Inquiry Basket