Recombinant Human XIAP protein(351-430 aa), C-His-tagged
Cat.No. : | XIAP-2812H |
Product Overview : | Recombinant Human XIAP protein(P98170)(351-430 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-430 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS |
Gene Name | XIAP X-linked inhibitor of apoptosis [ Homo sapiens ] |
Official Symbol | XIAP |
Synonyms | XIAP; X-linked inhibitor of apoptosis; API3, baculoviral IAP repeat containing 4 , BIRC4; baculoviral IAP repeat-containing protein 4; hILP; X-linked IAP; IAP-like protein; E3 ubiquitin-protein ligase XIAP; inhibitor of apoptosis protein 3; baculoviral IAP repeat-containing 4; X-linked inhibitor of apoptosis protein; API3; ILP1; MIHA; XLP2; BIRC4; IAP-3; hIAP3; hIAP-3; FLJ26913; |
Gene ID | 331 |
mRNA Refseq | NM_001167 |
Protein Refseq | NP_001158 |
MIM | 300079 |
UniProt ID | P98170 |
◆ Recombinant Proteins | ||
XIAP-245H | Recombinant Human XIAP Protein, GST/StrepII-tagged | +Inquiry |
XIAP-6157C | Recombinant Chicken XIAP | +Inquiry |
XIAP-243H | Active Recombinant Human XIAP | +Inquiry |
XIAP-247H | Recombinant Human XIAP protein, His-SUMO-tagged | +Inquiry |
XIAP-246H | Recombinant Human XIAP Protein, His/StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XIAP-263HCL | Recombinant Human XIAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XIAP Products
Required fields are marked with *
My Review for All XIAP Products
Required fields are marked with *