Recombinant Human XIAP protein(351-430 aa), C-His-tagged

Cat.No. : XIAP-2812H
Product Overview : Recombinant Human XIAP protein(P98170)(351-430 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 351-430 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS
Gene Name XIAP X-linked inhibitor of apoptosis [ Homo sapiens ]
Official Symbol XIAP
Synonyms XIAP; X-linked inhibitor of apoptosis; API3, baculoviral IAP repeat containing 4 , BIRC4; baculoviral IAP repeat-containing protein 4; hILP; X-linked IAP; IAP-like protein; E3 ubiquitin-protein ligase XIAP; inhibitor of apoptosis protein 3; baculoviral IAP repeat-containing 4; X-linked inhibitor of apoptosis protein; API3; ILP1; MIHA; XLP2; BIRC4; IAP-3; hIAP3; hIAP-3; FLJ26913;
Gene ID 331
mRNA Refseq NM_001167
Protein Refseq NP_001158
MIM 300079
UniProt ID P98170

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XIAP Products

Required fields are marked with *

My Review for All XIAP Products

Required fields are marked with *

0
cart-icon
0
compare icon