Recombinant Human XIAP protein(351-430 aa), C-His-tagged

• Cat.No.: XIAP-2812H
• Product Overview: Recombinant Human XIAP protein(P98170)(351-430 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 351-430 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS

Gene Information

• Gene Name: XIAP X-linked inhibitor of apoptosis [ Homo sapiens ]
• Official Symbol: XIAP
• Synonyms: XIAP; X-linked inhibitor of apoptosis; API3, baculoviral IAP repeat containing 4 , BIRC4; baculoviral IAP repeat-containing protein 4; hILP; X-linked IAP; IAP-like protein; E3 ubiquitin-protein ligase XIAP; inhibitor of apoptosis protein 3; baculoviral IAP repeat-containing 4; X-linked inhibitor of apoptosis protein; API3; ILP1; MIHA; XLP2; BIRC4; IAP-3; hIAP3; hIAP-3; FLJ26913
• Gene ID: 331
• mRNA Refseq: NM_001167
• Protein Refseq: NP_001158
• MIM: 300079
• UniProt ID: P98170