Recombinant Full Length Human XRCC4 Protein, C-Flag-tagged
Cat.No. : | XRCC4-420HFL |
Product Overview : | Recombinant Full Length Human XRCC4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.9 kDa |
AA Sequence : | MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Non-homologous end-joining |
Full Length : | Full L. |
Gene Name | XRCC4 X-ray repair cross complementing 4 [ Homo sapiens (human) ] |
Official Symbol | XRCC4 |
Synonyms | SSMED; hXRCC4 |
Gene ID | 7518 |
mRNA Refseq | NM_022550.4 |
Protein Refseq | NP_072044.1 |
MIM | 194363 |
UniProt ID | Q13426 |
◆ Recombinant Proteins | ||
XRCC4-11047Z | Recombinant Zebrafish XRCC4 | +Inquiry |
XRCC4-2852H | Recombinant Human XRCC4 protein(11-330 aa), C-His-tagged | +Inquiry |
XRCC4-30134TH | Recombinant Human XRCC4, His-tagged | +Inquiry |
XRCC4-420HFL | Recombinant Full Length Human XRCC4 Protein, C-Flag-tagged | +Inquiry |
Xrcc4-364M | Recombinant Mouse Xrcc4 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC4-255HCL | Recombinant Human XRCC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XRCC4 Products
Required fields are marked with *
My Review for All XRCC4 Products
Required fields are marked with *
0
Inquiry Basket