Recombinant Full Length Rat Interleukin-6 Receptor Subunit Alpha(Il6R) Protein, His-Tagged
Cat.No. : | RFL7419RF |
Product Overview : | Recombinant Full Length Rat Interleukin-6 receptor subunit alpha(Il6r) Protein (P22273) (20-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-462) |
Form : | Lyophilized powder |
AA Sequence : | LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHWVYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQWSKWSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQGSSPIPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPLKPTFLLVPLLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il6r |
Synonyms | Il6r; Il6ra; Interleukin-6 receptor subunit alpha; IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL-6R 1; CD antigen CD126 |
UniProt ID | P22273 |
◆ Recombinant Proteins | ||
IL6R-1560R | Recombinant Rhesus Monkey IL6R Protein, hIgG1-tagged | +Inquiry |
IL6R-1561R | Recombinant Rhesus Monkey IL6R Protein, hIgG4-tagged | +Inquiry |
IL6R-6383Z | Recombinant Zebrafish IL6R | +Inquiry |
IL6R-087H | Recombinant Human IL6R protein, His-Avi-tagged | +Inquiry |
IL6R-788H | Active Recombinant Human IL6R protein (Met1-Pro365), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il6r Products
Required fields are marked with *
My Review for All Il6r Products
Required fields are marked with *
0
Inquiry Basket