Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B15(Ugt2B15) Protein, His-Tagged
Cat.No. : | RFL4264RF |
Product Overview : | Recombinant Full Length Rat UDP-glucuronosyltransferase 2B15(Ugt2b15) Protein (P36511) (24-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-530) |
Form : | Lyophilized powder |
AA Sequence : | GKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSAFVFLDPKETSDLKFVTFPTSFSS HDLENFFTRFVNVWTYELPRDTCLSYFLYLQDTIDEYSDYCLTVCKEAVSNKQFMTKLQE SKFDVVFSDAIGPCGELIAELLQIPFLYSLRFSPGYTIEQYIGGVLFPPSYVPMIFSGLA GQMTFIERVHNMICMLYFDFWFQTFREKKWDPFYSKTLGRPTTLAEIMGKAEMWLIRSYW DLEFPHPISPNVDYIGGLHCKPAKPLPKDIEDFVQSSGEHGVVVFSLGSMVRNMTEEKAN IIAWALAQIPQKVLWRFDGKKPPTLGPNTRLYKWLPQNDLLGHPKTKAFVTHGGANGIYE AIHHGIPMIGIPLFAEQHDNIAHMVAKGAAVEVNFRTMSKSDLLNALEEVIDNPFYKKNA MWLSTIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRSLGHNLPWYQYHSLDVIGFLLSCVA VTVVLALKCFLFVYRFFVKKEKKTKNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ugt2b15 |
Synonyms | Ugt2b15; Ugt2b12; Ugt2b36; Ugt2b4; UDP-glucuronosyltransferase 2B15; UDPGT 2B15; UGT2B15; UDP-glucuronosyltransferase 2B36; UDPGT 2B36 |
UniProt ID | P36511 |
◆ Recombinant Proteins | ||
RFL4264RF | Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B15(Ugt2B15) Protein, His-Tagged | +Inquiry |
UGT2B15-1329H | Recombinant Human UGT2B15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UGT2B15-996HFL | Recombinant Full Length Human UGT2B15 Protein, C-Flag-tagged | +Inquiry |
UGT2B15-2311H | Recombinant Human UGT2B15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT2B15-1880HCL | Recombinant Human UGT2B15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ugt2b15 Products
Required fields are marked with *
My Review for All Ugt2b15 Products
Required fields are marked with *
0
Inquiry Basket