Recombinant Full Length Human UGT2B15 Protein, C-Flag-tagged
Cat.No. : | UGT2B15-996HFL |
Product Overview : | Recombinant Full Length Human UGT2B15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a glycosyltransferase that is invovled in the metabolism and elimination of toxic compounts, both endogenous and of xenobiotic origin. This gene plays a role in the regulation of estrogens and androgens. This locus is present in a cluster of similar genes and pseudogenes on chromosome 4. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.9 kDa |
AA Sequence : | MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSS AIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMK LQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFME RIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGG LHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGS NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH SLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Full Length : | Full L. |
Gene Name | UGT2B15 UDP glucuronosyltransferase family 2 member B15 [ Homo sapiens (human) ] |
Official Symbol | UGT2B15 |
Synonyms | HLUG4; UGT2B8; UDPGTH3; UDPGT 2B8; UDPGT2B15 |
Gene ID | 7366 |
mRNA Refseq | NM_001076.4 |
Protein Refseq | NP_001067.2 |
MIM | 600069 |
UniProt ID | P54855 |
◆ Recombinant Proteins | ||
UGT2B15-996HFL | Recombinant Full Length Human UGT2B15 Protein, C-Flag-tagged | +Inquiry |
UGT2B15-1329H | Recombinant Human UGT2B15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL4264RF | Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B15(Ugt2B15) Protein, His-Tagged | +Inquiry |
UGT2B15-2311H | Recombinant Human UGT2B15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT2B15-1880HCL | Recombinant Human UGT2B15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B15 Products
Required fields are marked with *
My Review for All UGT2B15 Products
Required fields are marked with *
0
Inquiry Basket