Recombinant Human ACTG2 Protein, GST-tagged

Cat.No. : ACTG2-218H
Product Overview : Human ACTG2 full-length ORF ( NP_001606.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Actins are highly conserved proteins that are involved in various types of cell motility and in the maintenance of the cytoskeleton. Three types of actins, alpha, beta and gamma, have been identified in vertebrates. Alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton and as mediators of internal cell motility. This gene encodes actin gamma 2; a smooth muscle actin found in enteric tissues. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Based on similarity to peptide cleavage of related actins, the mature protein of this gene is formed by removal of two N-terminal peptides.[provided by RefSeq, Dec 2010]
Molecular Mass : 68.3 kDa
AA Sequence : MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACTG2 actin, gamma 2, smooth muscle, enteric [ Homo sapiens ]
Official Symbol ACTG2
Synonyms ACTG2; actin, gamma 2, smooth muscle, enteric; ACTA3, ACTL3; actin, gamma-enteric smooth muscle; ACTSG; alpha-actin 3; alpha-actin-3; gamma-2-actin; actin-like protein; smooth muscle gamma actin; smooth muscle gamma-actin; ACT; ACTE; ACTA3; ACTL3;
Gene ID 72
mRNA Refseq NM_001199893
Protein Refseq NP_001186822
MIM 102545
UniProt ID P63267

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTG2 Products

Required fields are marked with *

My Review for All ACTG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon