Recombinant Human ACTG2 Protein, His-tagged
| Cat.No. : | ACTG2-3096H |
| Product Overview : | Recombinant Human ACTG2 protein(NP_001186822.1), fused to His-tag, was expressed in E. coli. |
| Availability | November 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | The protein has a calculated MW of 43.9 kDa. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF |
| Purity : | >90%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.2 mg/ml |
| Gene Name | ACTG2 actin gamma 2, smooth muscle [ Homo sapiens (human) ] |
| Official Symbol | ACTG2 |
| Synonyms | ACT; ACTE; VSCM; ACTA3; ACTL3; ACTSG; ACTG2 |
| Gene ID | 72 |
| mRNA Refseq | NM_001199893.2 |
| Protein Refseq | NP_001186822.1 |
| MIM | 102545 |
| UniProt ID | P63267 |
| ◆ Recombinant Proteins | ||
| ACTG2-820HF | Recombinant Full Length Human ACTG2 Protein, GST-tagged | +Inquiry |
| ACTG2-218H | Recombinant Human ACTG2 Protein, GST-tagged | +Inquiry |
| ACTG2-6727C | Recombinant Chicken ACTG2 | +Inquiry |
| ACTG2-3096H | Recombinant Human ACTG2 Protein, His-tagged | +Inquiry |
| ACTG2-6836H | Recombinant Human ACTG2 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTG2-9063HCL | Recombinant Human ACTG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTG2 Products
Required fields are marked with *
My Review for All ACTG2 Products
Required fields are marked with *
