Recombinant Human AKR1B1 Protein, GST-tagged
Cat.No. : | AKR1B1-409H |
Product Overview : | Human AKR1B1 full-length ORF ( AAH00260.1, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009] |
Molecular Mass : | 60.39 kDa |
AA Sequence : | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase) [ Homo sapiens ] |
Official Symbol | AKR1B1 |
Synonyms | AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804; |
Gene ID | 231 |
mRNA Refseq | NM_001628 |
Protein Refseq | NP_001619 |
MIM | 103880 |
UniProt ID | P15121 |
◆ Recombinant Proteins | ||
AKR1B1-292R | Recombinant Rhesus monkey AKR1B1 Protein, His-tagged | +Inquiry |
AKR1B1-283Z | Recombinant Zebrafish AKR1B1 | +Inquiry |
AKR1B1-9156H | Active Recombinant Human AKR1B1, His-tagged | +Inquiry |
AKR1B1-252R | Recombinant Rat AKR1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1B1-304H | Recombinant Human AKR1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1B1-47HCL | Recombinant Human AKR1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1B1 Products
Required fields are marked with *
My Review for All AKR1B1 Products
Required fields are marked with *
0
Inquiry Basket