Recombinant Human AKR1B1 Protein, GST-tagged

Cat.No. : AKR1B1-409H
Product Overview : Human AKR1B1 full-length ORF ( AAH00260.1, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009]
Molecular Mass : 60.39 kDa
AA Sequence : MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase) [ Homo sapiens ]
Official Symbol AKR1B1
Synonyms AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804;
Gene ID 231
mRNA Refseq NM_001628
Protein Refseq NP_001619
MIM 103880
UniProt ID P15121

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKR1B1 Products

Required fields are marked with *

My Review for All AKR1B1 Products

Required fields are marked with *

0
cart-icon