Recombinant Human ALDH1A2 Protein, GST-tagged
Cat.No. : | ALDH1A2-439H |
Product Overview : | Human ALDH1A2 full-length ORF ( NP_733797.1, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2011] |
Molecular Mass : | 79.5 kDa |
AA Sequence : | MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALDH1A2 aldehyde dehydrogenase 1 family member A2 [ Homo sapiens (human) ] |
Official Symbol | ALDH1A2 |
Synonyms | ALDH1A2; aldehyde dehydrogenase 1 family member A2; RALDH2; RALDH2-T; RALDH(II); retinal dehydrogenase 2; RALDH 2; retinaldehyde-specific dehydrogenase type 2; EC 1.2.1.36 |
Gene ID | 8845 |
mRNA Refseq | NM_001206897 |
Protein Refseq | NP_001193826 |
MIM | 603687 |
UniProt ID | O94788 |
◆ Recombinant Proteins | ||
ALDH1A2-0036H | Recombinant Human ALDH1A2 Protein (Met1-Val422), N-His-tagged | +Inquiry |
ALDH1A2-0326H | Recombinant Human ALDH1A2 Protein (L26-S518), His tagged | +Inquiry |
ALDH1A2-439H | Recombinant Human ALDH1A2 Protein, GST-tagged | +Inquiry |
ALDH1A2-0035H | Recombinant Human ALDH1A2 Protein (Met1-Ser518), N-His-tagged | +Inquiry |
ALDH1A2-1112H | Recombinant Human ALDH1A2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1A2-8921HCL | Recombinant Human ALDH1A2 293 Cell Lysate | +Inquiry |
ALDH1A2-8920HCL | Recombinant Human ALDH1A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH1A2 Products
Required fields are marked with *
My Review for All ALDH1A2 Products
Required fields are marked with *
0
Inquiry Basket