"AMBP" Related Products

Expand
Expand

Recombinant Human AMBP protein, GST-tagged

Cat.No.: AMBP-515H
Product Overview: Human AMBP full-length ORF ( AAH41593, 19 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 62.48 kDa
AA Sequence: AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: AMBP alpha-1-microglobulin/bikunin precursor [ Homo sapiens ]
Official Symbol: AMBP
Synonyms: AMBP; alpha-1-microglobulin/bikunin precursor; ITI, ITIL; protein AMBP; bikunin; complex forming glycoprotein heterogeneous in charge; EDC1; growth inhibiting protein 19; HCP; HI30; IATIL; inter alpha trypsin inhibitor light chain; ITILC; protein HC; trypstatin; uristatin; uronic acid rich protein; UTI; uronic-acid-rich protein; growth-inhibiting protein 19; inter-alpha-trypsin inhibitor light chain; complex-forming glycoprotein heterogeneous in charge; A1M; ITI; ITIL;
Gene ID: 259
mRNA Refseq: NM_001633
Protein Refseq: NP_001624
MIM: 176870
UniProt ID: P02760

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.