Recombinant Human ANGPTL4, GST-tagged
Cat.No. : | ANGPTL4-27H |
Product Overview : | Recombinant Human ANGPTL4(26 a.a. - 406 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. |
Molecular Mass : | 67.65 kDa |
AA Sequence : | GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPE VLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPA HNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGD PHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVP FSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPI AAEAAS |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANGPTL4 angiopoietin-like 4 [ Homo sapiens ] |
Official Symbol | ANGPTL4 |
Synonyms | ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; angiopoietin related protein 4; ARP4; fasting induced adipose factor; FIAF; hepatic angiopoietin related protein; hepatic fibrinogen/angiopoietin related protein; HFARP; NL2; peroxisome prolife |
Gene ID | 51129 |
mRNA Refseq | NM_001039667 |
Protein Refseq | NP_001034756 |
MIM | 605910 |
UniProt ID | Q9BY76 |
Chromosome Location | 19p13.3 |
Pathway | Developmental Biology; PPAR signaling pathway; Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) |
Function | enzyme inhibitor activity; protein binding |
◆ Recombinant Proteins | ||
ANGPTL4-403H | Recombinant Human ANGPTL4, Fibrinogen-like Domain, FLAG-tagged | +Inquiry |
ANGPTL4-5744P | Recombinant Pig ANGPTL4 protein, His-tagged | +Inquiry |
ANGPTL4-129C | Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, N-10*His-tagged | +Inquiry |
ANGPTL4-232H | Recombinant Human ANGPTL4(Phe20-Thr263) Protein, C-Fc-tagged | +Inquiry |
ANGPTL4-27H | Recombinant Human ANGPTL4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPTL4 Products
Required fields are marked with *
My Review for All ANGPTL4 Products
Required fields are marked with *
0
Inquiry Basket