Recombinant Human ANGPTL4, GST-tagged

Cat.No. : ANGPTL4-27H
Product Overview : Recombinant Human ANGPTL4(26 a.a. - 406 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.
Molecular Mass : 67.65 kDa
AA Sequence : GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPE VLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPA HNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGD PHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVP FSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPI AAEAAS
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANGPTL4 angiopoietin-like 4 [ Homo sapiens ]
Official Symbol ANGPTL4
Synonyms ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; angiopoietin related protein 4; ARP4; fasting induced adipose factor; FIAF; hepatic angiopoietin related protein; hepatic fibrinogen/angiopoietin related protein; HFARP; NL2; peroxisome prolife
Gene ID 51129
mRNA Refseq NM_001039667
Protein Refseq NP_001034756
MIM 605910
UniProt ID Q9BY76
Chromosome Location 19p13.3
Pathway Developmental Biology; PPAR signaling pathway; Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
Function enzyme inhibitor activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANGPTL4 Products

Required fields are marked with *

My Review for All ANGPTL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon