Recombinant Human AOX1 Protein (236-421 aa), His-tagged
Cat.No. : | AOX1-329H |
Product Overview : | Recombinant Human AOX1 Protein (236-421 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolismn. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 236-421 aa |
Description : | Oxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide and N-methylphthalazinium, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. Also may catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 24.6 kDa |
AA Sequence : | FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | AOX1 aldehyde oxidase 1 [ Homo sapiens ] |
Official Symbol | AOX1 |
Synonyms | AOX1; aldehyde oxidase 1; aldehyde oxidase; AO; AOH1; |
Gene ID | 316 |
mRNA Refseq | NM_001159 |
Protein Refseq | NP_001150 |
MIM | 602841 |
UniProt ID | Q06278 |
◆ Recombinant Proteins | ||
AOX1-329H | Recombinant Human AOX1 Protein (236-421 aa), His-tagged | +Inquiry |
Aox1-617M | Recombinant Mouse Aox1 Protein, MYC/DDK-tagged | +Inquiry |
AOX1-110H | Active Recombinant Human AOX1 Protein | +Inquiry |
AOX1-300C | Recombinant Cynomolgus AOX1 Protein, His-tagged | +Inquiry |
AOX1-3316C | Recombinant Chicken AOX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AOX1-8821HCL | Recombinant Human AOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AOX1 Products
Required fields are marked with *
My Review for All AOX1 Products
Required fields are marked with *
0
Inquiry Basket