Recombinant Human AP3B2 protein(973-1078aa), His&Myc-tagged
| Cat.No. : | AP3B2-976H |
| Product Overview : | Recombinant Human AP3B2 protein(Q13367)(973-1078aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 973-1078aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ |
| Gene Name | AP3B2 adaptor-related protein complex 3, beta 2 subunit [ Homo sapiens ] |
| Official Symbol | AP3B2 |
| Synonyms | NAPTB |
| Gene ID | 8120 |
| mRNA Refseq | NM_004644.3 |
| Protein Refseq | NP_004635.2 |
| MIM | 602166 |
| UniProt ID | Q13367 |
| ◆ Recombinant Proteins | ||
| AP3B2-920H | Recombinant Human AP3B2 protein, His-tagged | +Inquiry |
| AP3B2-976H | Recombinant Human AP3B2 protein(973-1078aa), His&Myc-tagged | +Inquiry |
| AP3B2-604M | Recombinant Mouse AP3B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AP3B2-1744M | Recombinant Mouse AP3B2 Protein | +Inquiry |
| AP3B2-9720H | Recombinant Human AP3B2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AP3B2-8809HCL | Recombinant Human AP3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP3B2 Products
Required fields are marked with *
My Review for All AP3B2 Products
Required fields are marked with *
