Recombinant Human APEX1 protein, GST-tagged
Cat.No. : | APEX1-677H |
Product Overview : | Human APEX1 full-length ORF ( AAH02338, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 60.72 kDa |
AA Sequence : | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ] |
Official Symbol | APEX1 |
Synonyms | APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX; |
Gene ID | 328 |
mRNA Refseq | NM_001244249 |
Protein Refseq | NP_001231178 |
MIM | 107748 |
UniProt ID | P27695 |
◆ Recombinant Proteins | ||
APEX1-2021HFL | Recombinant Full Length Human APEX1 Protein, C-Flag-tagged | +Inquiry |
APEX1-713R | Recombinant Rat APEX1 Protein | +Inquiry |
APEX1-12593Z | Recombinant Zebrafish APEX1 | +Inquiry |
APEX1-677H | Recombinant Human APEX1 protein, GST-tagged | +Inquiry |
APEX1-4792H | Recombinant Human APEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APEX1 Products
Required fields are marked with *
My Review for All APEX1 Products
Required fields are marked with *
0
Inquiry Basket