"APEX1" Related Products

Expand
Expand
Expand

Recombinant Human APEX1 protein, GST-tagged

Cat.No. : APEX1-677H
Product Overview : Human APEX1 full-length ORF ( AAH02338, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 60.72 kDa
AA Sequence : MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Figure :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
Official Symbol : APEX1
Synonyms : APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX;
Gene ID : 328
mRNA Refseq : NM_001244249
Protein Refseq : NP_001231178
MIM : 107748
UniProt ID : P27695

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.