Recombinant Human APEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | APEX1-4792H |
Product Overview : | APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542380) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | APEX1 apurinic/apyrimidinic endodeoxyribonuclease 1 [ Homo sapiens (human) ] |
Official Symbol | APEX1 |
Synonyms | APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX; |
Gene ID | 328 |
mRNA Refseq | NM_080649 |
Protein Refseq | NP_542380 |
MIM | 107748 |
UniProt ID | P27695 |
◆ Recombinant Proteins | ||
APEX1-46H | Recombinant Human APEX1 protein, His-tagged | +Inquiry |
APEX1-0348H | Recombinant Human APEX1 Protein (Pro2-Leu318), Tag Free | +Inquiry |
APEX1-1330H | Recombinant Human APEX1 Protein (32-318 aa), His-tagged | +Inquiry |
APEX1-1523HF | Recombinant Full Length Human APEX1 Protein, GST-tagged | +Inquiry |
APEX1-45H | Recombinant Human APEX1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APEX1 Products
Required fields are marked with *
My Review for All APEX1 Products
Required fields are marked with *
0
Inquiry Basket