Recombinant Human APEX1, T7 -tagged
Cat.No. : | APEX1-27360TH |
Product Overview : | Recombinant full length Human APE1 with an N terminal T7 tag; 332 amino acids with tag, Predicted MWt 36.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 318 amino acids |
Description : | Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5 to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. |
Conjugation : | T7 |
Molecular Weight : | 36.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Sequence Similarities : | Belongs to the DNA repair enzymes AP/ExoA family. |
Gene Name | APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ] |
Official Symbol | APEX1 |
Synonyms | APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; |
Gene ID | 328 |
mRNA Refseq | NM_001244249 |
Protein Refseq | NP_001231178 |
MIM | 107748 |
Uniprot ID | P27695 |
Chromosome Location | 14q11.2 |
Pathway | BER complex, organism-specific biosystem; BER complex, conserved biosystem; Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; |
Function | 3-5 exonuclease activity; 3-5 exonuclease activity; DNA binding; DNA-(apurinic or apyrimidinic site) lyase activity; DNA-(apurinic or apyrimidinic site) lyase activity; |
◆ Recombinant Proteins | ||
APEX1-2528H | Recombinant Human APEX1 protein, His-tagged | +Inquiry |
APEX1-45H | Recombinant Human APEX1 protein, GST-tagged | +Inquiry |
APEX1-4792H | Recombinant Human APEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
APEX1-2705H | Recombinant Human APEX1 protein(11-90 aa), C-His-tagged | +Inquiry |
APEX1-354H | Recombinant Human APEX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APEX1 Products
Required fields are marked with *
My Review for All APEX1 Products
Required fields are marked with *
0
Inquiry Basket