Recombinant Human ARMC4 protein, GST-tagged

Cat.No. : ARMC4-828H
Product Overview : Human ARMC4 partial ORF ( NP_060546, 945 a.a. - 1044 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene contains ten Armadillo repeat motifs (ARMs) and one HEAT repeat, and is thought to be involved in ciliary and flagellar movement. This protein has been shown to localize to the ciliary axonemes and at the ciliary base of respiratory cells. Studies indicate that mutations in this gene cause partial outer dynein arm (ODA) defects in respiratory cilia. The cilia of cells with mutations in this gene displayed either reduced ciliary beat frequency and amplitude, or, complete immotility. Some individuals with primary ciliary dyskensia (PCD) have been shown to have mutations in this gene. PCD is characterized by chronic airway disease and left/right body asymmetry defects. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]
Molecular Mass : 36.74 kDa
AA Sequence : AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARMC4 armadillo repeat containing 4 [ Homo sapiens ]
Official Symbol ARMC4
Synonyms ARMC4; armadillo repeat containing 4; armadillo repeat-containing protein 4; DKFZP434P1735; FLJ10376; FLJ10817; FLJ32798; RP11-691I13.1; DKFZp434P1735;
Gene ID 55130
mRNA Refseq NM_018076
Protein Refseq NP_060546
UniProt ID Q5T2S8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMC4 Products

Required fields are marked with *

My Review for All ARMC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon