"ASF1A" Related Products

Expand
Expand
Expand

Recombinant Human ASF1A protein, His/T7-tagged

Cat.No.: ASF1A-46H
Product Overview: Recombinant Human ASF1A(Met1-Met204) fused with a T7 tag at the N-terminus, 6His tag at the C-terminus was expressed in E. coli.
Description: Human Histone Chaperone ASF1A (ASF1A) belongs to the H3/H4 family of histone chaperone proteins. ASF1A is ubiquitously expressed in many cells and tissues, interacting with histones H3 and H4. ASF1A cooperates with Chromatin Assembly Factor 1 to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. In addition, ASF1A is necessary for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.
Source: E. coli
Species: Human
Tag: His/T7
Form: Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 150mM NaCl, pH 8.0.
AA Sequence: MASMTGGQQMGRGSMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNE YTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPS ASKGWSTSENSLNVMLESHMDCMLEHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol: ASF1A
Synonyms: ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146;
Gene ID: 25842
mRNA Refseq: NM_014034
Protein Refseq: NP_054753
MIM: 609189
UniProt ID: Q9Y294
Chromosome Location: 6q22.31
Function: chromatin binding; histone binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.