Recombinant Human ASF1A protein, T7/His-tagged
Cat.No. : | ASF1A-197H |
Product Overview : | Recombinant human ASF1a (204 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSA ESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELR ENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLE SHMDCM |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ASF1A |
Synonyms | ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146; |
Gene ID | 25842 |
mRNA Refseq | NM_014034 |
Protein Refseq | NP_054753 |
MIM | 609189 |
UniProt ID | Q9Y294 |
Chromosome Location | 6q22.31 |
Function | chromatin binding; histone binding; protein binding; |
◆ Recombinant Proteins | ||
ASF1A-9929H | Recombinant Human ASF1A, GST-tagged | +Inquiry |
ASF1A-426R | Recombinant Rhesus monkey ASF1A Protein, His-tagged | +Inquiry |
ASF1A-508H | Recombinant Human ASF1A, His-tagged | +Inquiry |
ASF1A-787M | Recombinant Mouse ASF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ASF1A-255R | Recombinant Rhesus Macaque ASF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASF1A-8653HCL | Recombinant Human ASF1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASF1A Products
Required fields are marked with *
My Review for All ASF1A Products
Required fields are marked with *
0
Inquiry Basket