Recombinant Human ASL protein, GST-tagged
Cat.No. : | ASL-909H |
Product Overview : | Human ASL full-length ORF ( AAH08195, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 76.78 kDa |
AA Sequence : | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAELLFWASLCMTHLSRMAEDLILYCTKEFSFVQPSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASL argininosuccinate lyase [ Homo sapiens ] |
Official Symbol | ASL |
Synonyms | ASL; argininosuccinate lyase; arginosuccinase; argininosuccinase; ASAL; |
Gene ID | 435 |
mRNA Refseq | NM_000048 |
Protein Refseq | NP_000039 |
MIM | 608310 |
UniProt ID | P04424 |
◆ Recombinant Proteins | ||
ASL-482R | Recombinant Rat ASL Protein, His (Fc)-Avi-tagged | +Inquiry |
ASL-826R | Recombinant Rat ASL Protein | +Inquiry |
ASL-1888HFL | Recombinant Full Length Human ASL Protein, C-Flag-tagged | +Inquiry |
ASL-791M | Recombinant Mouse ASL Protein, His (Fc)-Avi-tagged | +Inquiry |
ASL-9935H | Recombinant Human ASL, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASL-001HCL | Recombinant Human ASL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASL Products
Required fields are marked with *
My Review for All ASL Products
Required fields are marked with *
0
Inquiry Basket