Recombinant Human ATOX1 protein, GST-tagged
Cat.No. : | ATOX1-958H |
Product Overview : | Human ATOX1 full-length ORF ( ADR82784.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 7.5 kDa |
AA Sequence : | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ] |
Official Symbol | ATOX1 |
Synonyms | ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1; metal transport protein ATX1; ATX1; MGC138453; MGC138455; |
Gene ID | 475 |
mRNA Refseq | NM_004045 |
Protein Refseq | NP_004036 |
MIM | 602270 |
UniProt ID | O00244 |
◆ Recombinant Proteins | ||
ATOX1-5084C | Recombinant Chicken ATOX1 | +Inquiry |
ATOX1-2741H | Recombinant Human Antioxidant Protein 1 Homolog (Yeast) | +Inquiry |
ATOX1-26191TH | Recombinant Human ATOX1, His-tagged | +Inquiry |
ATOX1-8172Z | Recombinant Zebrafish ATOX1 | +Inquiry |
ATOX1-9994H | Recombinant Human ATOX1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATOX1 Products
Required fields are marked with *
My Review for All ATOX1 Products
Required fields are marked with *