Recombinant Human ATOX1, His-tagged

• Cat.No.: ATOX1-26191TH
• Product Overview: Recombinant full length Human ATOX1 with N terminal His tag; 88 amino acids with a predicted MWt 9.5kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 68 amino acids
• Description: This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
• Conjugation: HIS
• Molecular Weight: 9.500kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.24% Tris, 0.02% DTT, 10% Glycerol
• Storage: Store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
• Sequence Similarities: Belongs to the ATX1 family.Contains 1 HMA domain.

Gene Information

• Gene Name: ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
• Official Symbol: ATOX1
• Synonyms: ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1
• Gene ID: 475
• mRNA Refseq: NM_004045
• Protein Refseq: NP_004036
• MIM: 602270
• Uniprot ID: O00244
• Chromosome Location: 5q32
• Pathway: Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem
• Function: copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity