Recombinant Human ATOX1, His-tagged

Cat.No. : ATOX1-26191TH
Product Overview : Recombinant full length Human ATOX1 with N terminal His tag; 88 amino acids with a predicted MWt 9.5kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 68 amino acids
Description : This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
Conjugation : HIS
Molecular Weight : 9.500kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.24% Tris, 0.02% DTT, 10% Glycerol
Storage : Store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Sequence Similarities : Belongs to the ATX1 family.Contains 1 HMA domain.
Gene Name ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
Official Symbol ATOX1
Synonyms ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1;
Gene ID 475
mRNA Refseq NM_004045
Protein Refseq NP_004036
MIM 602270
Uniprot ID O00244
Chromosome Location 5q32
Pathway Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATOX1 Products

Required fields are marked with *

My Review for All ATOX1 Products

Required fields are marked with *

0
cart-icon