Recombinant Human ATOX1, His-tagged
Cat.No. : | ATOX1-26191TH |
Product Overview : | Recombinant full length Human ATOX1 with N terminal His tag; 88 amino acids with a predicted MWt 9.5kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 68 amino acids |
Description : | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
Conjugation : | HIS |
Molecular Weight : | 9.500kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 0.02% DTT, 10% Glycerol |
Storage : | Store at -20°C or lower.Aliquot to avoid repeated freezing and thawing. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE |
Sequence Similarities : | Belongs to the ATX1 family.Contains 1 HMA domain. |
Gene Name | ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ] |
Official Symbol | ATOX1 |
Synonyms | ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1; |
Gene ID | 475 |
mRNA Refseq | NM_004045 |
Protein Refseq | NP_004036 |
MIM | 602270 |
Uniprot ID | O00244 |
Chromosome Location | 5q32 |
Pathway | Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
Function | copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity; |
◆ Recombinant Proteins | ||
ATOX1-9994H | Recombinant Human ATOX1 protein, GST-tagged | +Inquiry |
ATOX1-26679TH | Recombinant Human ATOX1 | +Inquiry |
ATOX1-506R | Recombinant Rat ATOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATOX1-452H | Recombinant Human ATX1 Antioxidant Protein 1 Homolog (Yeast) | +Inquiry |
ATOX1-2100M | Recombinant Mouse ATOX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATOX1 Products
Required fields are marked with *
My Review for All ATOX1 Products
Required fields are marked with *