Recombinant Human AVEN protein, GST-tagged
Cat.No. : | AVEN-1041H |
Product Overview : | Human AVEN full-length ORF ( NP_065104.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AVEN (Apoptosis And Caspase Activation Inhibitor) is a Protein Coding gene. Diseases associated with AVEN include Schizoid Personality Disorder and Alzheimer Disease Mitochondrial. Among its related pathways are Apoptosis and Autophagy. |
Molecular Mass : | 64.9 kDa |
AA Sequence : | MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AVEN apoptosis, caspase activation inhibitor [ Homo sapiens ] |
Official Symbol | AVEN |
Synonyms | AVEN; apoptosis, caspase activation inhibitor; cell death regulator Aven; cell death regulator aven; PDCD12; programmed cell death 12; |
Gene ID | 57099 |
mRNA Refseq | NM_020371 |
Protein Refseq | NP_065104 |
MIM | 605265 |
UniProt ID | Q9NQS1 |
◆ Recombinant Proteins | ||
AVEN-1249C | Recombinant Chicken AVEN | +Inquiry |
Aven-1790M | Recombinant Mouse Aven Protein, Myc/DDK-tagged | +Inquiry |
AVEN-01H | Recombinant Human AVEN Protein, DYKDDDDK-tagged | +Inquiry |
AVEN-4283Z | Recombinant Zebrafish AVEN | +Inquiry |
AVEN-1041H | Recombinant Human AVEN protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVEN Products
Required fields are marked with *
My Review for All AVEN Products
Required fields are marked with *
0
Inquiry Basket