Recombinant Human B2M Protein, His-tagged
Cat.No. : | B2M-104H |
Product Overview : | Recombinant human B2M protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 119 |
Description : | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. |
Form : | Lyophilized |
Molecular Mass : | 12.6 kDa |
AA Sequence : | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | B2M beta-2-microglobulin [ Homo sapiens (human) ] |
Official Symbol | B2M |
Synonyms | B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules; |
Gene ID | 567 |
mRNA Refseq | NM_004048 |
Protein Refseq | NP_004039 |
MIM | 109700 |
UniProt ID | P61769 |
◆ Recombinant Proteins | ||
B2M-569R | Recombinant Rat B2M Protein, His (Fc)-Avi-tagged | +Inquiry |
B2M-206H | Recombinant Human B2M Protein | +Inquiry |
B2M-002H | Recombinant Human B2M protein, GST-tagged | +Inquiry |
B2M-218H | Recombinant Human B2M, C13&N15-labeled | +Inquiry |
B2M-26790TH | Recombinant Human B2M | +Inquiry |
◆ Native Proteins | ||
B2M-13H | Native Human B2M | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *
0
Inquiry Basket