Recombinant Human BASP1 protein, GST-tagged

Cat.No. : BASP1-081H
Product Overview : Human BASP1 full-length ORF ( NP_006308.3, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 50.6 kDa
AA Sequence : MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAPAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPLRGGEAPKAAEAAAGPRPRAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BASP1 brain abundant, membrane attached signal protein 1 [ Homo sapiens ]
Official Symbol BASP1
Synonyms BASP1; brain abundant, membrane attached signal protein 1; brain acid soluble protein 1; CAP 23; CAP23; NAP 22; NAP22; brain acid-soluble protein 1; neuronal axonal membrane protein NAP-22; neuronal tissue-enriched acidic protein; 22 kDa neuronal tissue-enriched acidic protein; CAP-23; NAP-22; MGC8555;
Gene ID 10409
mRNA Refseq NM_006317
Protein Refseq NP_006308
MIM 605940
UniProt ID P80723

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BASP1 Products

Required fields are marked with *

My Review for All BASP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon