Recombinant Human CBX1 Protein, GST-Tagged

Cat.No. : CBX1-0477H
Product Overview : Human CBX1 full-length ORF (NP_006798.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 47.8 kDa
AA Sequence : MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CBX1 chromobox homolog 1 [ Homo sapiens ]
Official Symbol CBX1
Synonyms CBX1; chromobox homolog 1; chromobox homolog 1 (Drosophila HP1 beta); chromobox protein homolog 1; CBX; HP1 beta homolog (Drosophila); HP1 BETA; HP1Hs beta; M31; MOD1; HP1 beta homolog; modifier 1 protein; heterochromatin protein 1-beta; heterochromatin protein p25 beta; heterochromatin protein 1 homolog beta; chromobox homolog 1 (HP1 beta homolog Drosophila); p25beta; HP1-BETA; HP1Hsbeta; HP1Hs-beta;
Gene ID 10951
mRNA Refseq NM_001127228
Protein Refseq NP_001120700
MIM 604511
UniProt ID P83916

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBX1 Products

Required fields are marked with *

My Review for All CBX1 Products

Required fields are marked with *

0
cart-icon