Recombinant Human CBX3 protein, GST-tagged
Cat.No. : | CBX3-268H |
Product Overview : | Recombinant Human CBX3(1 a.a. - 183 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 183 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 45.87 kDa |
AA Sequence : | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEA FLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADL VLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CBX3 chromobox homolog 3 [ Homo sapiens ] |
Official Symbol | CBX3 |
Synonyms | CBX3; chromobox homolog 3; chromobox homolog 3 (Drosophila HP1 gamma); chromobox protein homolog 3; HP1 gamma homolog (Drosophila); HP1Hs gamma; HP1 gamma homolog; modifier 2 protein; heterochromatin-like protein 1; heterochromatin protein HP1 gamma; heterochromatin protein 1 homolog gamma; chromobox homolog 3 (HP1 gamma homolog, Drosophila); HECH; HP1-GAMMA; HP1Hs-gamma; |
Gene ID | 11335 |
mRNA Refseq | NM_007276 |
Protein Refseq | NP_009207 |
MIM | 604477 |
UniProt ID | Q13185 |
Chromosome Location | 7p15.2 |
Pathway | Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA Polymerase I Chain Elongation, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; |
Function | enzyme binding; identical protein binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
CBX3-270H | Recombinant Human CBX3 protein, MYC/DDK-tagged | +Inquiry |
CBX3-647R | Recombinant Rhesus monkey CBX3 Protein, His-tagged | +Inquiry |
CBX3-475R | Recombinant Rhesus Macaque CBX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX3-10768H | Recombinant Human CBX3, His-tagged | +Inquiry |
Cbx3-793M | Recombinant Mouse Cbx3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX3-7805HCL | Recombinant Human CBX3 293 Cell Lysate | +Inquiry |
CBX3-7804HCL | Recombinant Human CBX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX3 Products
Required fields are marked with *
My Review for All CBX3 Products
Required fields are marked with *