- Chicken(1)
- Cynomolgus Monkey(2)
- Dog(1)
- Human(14)
- Mouse(7)
- Rat(2)
- Rhesus(3)
- Rhesus Macaque(2)
Recombinant Human CCL17
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Cat.No. : | CCL17-30148TH Optional Service: Optional requirements on this protein |
Product Overview : | Highly pure (>98%) recombinant human TARC. |
Description : | This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. |
Source : | E. coli |
Tissue specificity : | Expressed at high levels in thymus and at low levels in the lung, colon and small intestine. |
Form : | Lyophilised:Please reconstitute this product in 200ul water. |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | Human TARC is an 8.0 kDa protein containing 71 amino acid residues:ARGTNVGRECCLEYFKGAIPLRKLK TWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV KYLQSLERS |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name : | CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ] |
Official Symbol : | CCL17 |
Synonyms : | CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; |
Gene ID : | 6361 |
mRNA Refseq : | NM_002987 |
Protein Refseq : | NP_002978 |
MIM : | 601520 |
Uniprot ID : | Q92583 |
Chromosome Location : | 16q13 |
Pathway : | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function : | chemokine activity; receptor binding; |
◆ Recombinant Protein
CCL17-0614H | Recombinant Human CCL17 Protein, GST-Tagged | +Inquiry |
CCL17-508R | Recombinant Rhesus Macaque CCL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl17-129M | Recombinant Mouse Ccl17 Protein | +Inquiry |
CCL17-10H | Recombinant Human CCL17 Protein | +Inquiry |
CCL17-055C | Recombinant Human CCL17 Protein (71 aa) | +Inquiry |
|
◆ Lysates
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
|
CCL1CCL11Ccl12CCL13CCL14CCL15CCL16CCL17CCL18CCL19CCL2CCL20CCL21Ccl21cCCL22CCL23CCL24CCL25CCL26CCL27Ccl27aCCL28CCL3CCL3L1Ccl4CCL5Ccl6CCL7CCL8Ccl9CCL4L2Ccl21aCCL4L1CCL3L3Ccl21bCcl27b
Easy access to products and services you need from our library via powerful searching tools.
Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy