Recombinant Human CCL17
Cat.No. : | CCL17-30148TH |
Product Overview : | Highly pure (>98%) recombinant human TARC. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. |
Source : | E. coli |
Tissue specificity : | Expressed at high levels in thymus and at low levels in the lung, colon and small intestine. |
Form : | Lyophilised:Please reconstitute this product in 200ul water. |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | Human TARC is an 8.0 kDa protein containing 71 amino acid residues:ARGTNVGRECCLEYFKGAIPLRKLK TWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV KYLQSLERS |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Tag : | Non |
Gene Name : | CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ] |
Official Symbol : | CCL17 |
Synonyms : | CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; |
Gene ID : | 6361 |
mRNA Refseq : | NM_002987 |
Protein Refseq : | NP_002978 |
MIM : | 601520 |
Uniprot ID : | Q92583 |
Chromosome Location : | 16q13 |
Pathway : | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function : | chemokine activity; receptor binding; |
Products Types
◆ Recombinant Protein | ||
CCL17-508R | Recombinant Rhesus Macaque CCL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL17-10H | Recombinant Human CCL17 Protein | +Inquiry |
CCL17-0614H | Recombinant Human CCL17 Protein, GST-Tagged | +Inquiry |
Ccl17-129M | Active Recombinant Mouse Ccl17 Protein | +Inquiry |
CCL17-6432D | Recombinant Dog CCL17 protein(24-99aa), MBP&His-Avi-tagged, Biotinylated | +Inquiry |
◆ Lysates | ||
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL17 Products
Required fields are marked with *
My Review for All CCL17 Products
Required fields are marked with *
0
Inquiry Basket