Recombinant Human CCL17
Cat.No. : | CCL17-30148TH |
Product Overview : | Highly pure (>98%) recombinant human TARC. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. |
Tissue specificity : | Expressed at high levels in thymus and at low levels in the lung, colon and small intestine. |
Form : | Lyophilised:Please reconstitute this product in 200ul water. |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | Human TARC is an 8.0 kDa protein containing 71 amino acid residues:ARGTNVGRECCLEYFKGAIPLRKLK TWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV KYLQSLERS |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name | CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ] |
Official Symbol | CCL17 |
Synonyms | CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; |
Gene ID | 6361 |
mRNA Refseq | NM_002987 |
Protein Refseq | NP_002978 |
MIM | 601520 |
Uniprot ID | Q92583 |
Chromosome Location | 16q13 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function | chemokine activity; receptor binding; |
◆ Recombinant Proteins | ||
CCL17-41H | Recombinant Human CCL17 Protein | +Inquiry |
CCL17-1471H | Recombinant Human CCL17 Protein (Ala24-Ser94), N-GST tagged | +Inquiry |
CCL17-508R | Recombinant Rhesus Macaque CCL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL17-858R | Active Recombinant Rhesus CCL17 protein, His-tagged | +Inquiry |
CCL17-239H | Recombinant Human C motif chemokine ligand 17 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL17 Products
Required fields are marked with *
My Review for All CCL17 Products
Required fields are marked with *