Recombinant Human CCL17 CCL17-30148TH

Recombinant Human CCL17

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CCL17

Recombinant Human CCL17

Online Inquiry

CCL17 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CCL17-30148TH Optional Service: Optional requirements on this protein
Product Overview : Highly pure (>98%) recombinant human TARC.
Description : This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
Source : E. coli
Tissue specificity : Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
Form : Lyophilised:Please reconstitute this product in 200ul water.
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human TARC is an 8.0 kDa protein containing 71 amino acid residues:ARGTNVGRECCLEYFKGAIPLRKLK TWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV KYLQSLERS
Sequence Similarities : Belongs to the intercrine beta (chemokine CC) family.
Gene Name : CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ]
Official Symbol : CCL17
Synonyms : CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC;
Gene ID : 6361
mRNA Refseq : NM_002987
Protein Refseq : NP_002978
MIM : 601520
Uniprot ID : Q92583
Chromosome Location : 16q13
Pathway : Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function : chemokine activity; receptor binding;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy