Recombinant Human CCL18 Protein
Cat.No. : | CCL18-45H |
Product Overview : | Recombinant Human CCL18 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 68 amino acid |
Description : | CCL18, previously identified as DC-CK1 or PARC, is expressed by dendritic cells and is chemotactic for naïve T cells. The 7 transmembrane GPCR CCR8 and the 6 transmembrane protein, membrane-associated phosphatidylinositol transfer protein 3, PITPNM3, are receptors for CCL18. The ligand was shown to have antagonist properties against CCR3. |
Form : | Lyophilized |
Molecular Mass : | 7.78011 kDa |
AA Sequence : | QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQI CADPNKKWVQKYISDLKLNA |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 18 |
Gene Name | CCL18 C-C motif chemokine ligand 18 [ Homo sapiens (human) ] |
Official Symbol | CCL18 |
Synonyms | CKb7; PARC; AMAC1; DCCK1; MIP-4; AMAC-1; DC-CK1; SCYA18 |
Gene ID | 6362 |
mRNA Refseq | NM_002988 |
Protein Refseq | NP_002979 |
MIM | 603757 |
UniProt ID | P55774 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL18 Products
Required fields are marked with *
My Review for All CCL18 Products
Required fields are marked with *