Active Recombinant Human CCL8 Protein (76 aa)
Cat.No. : | CCL8-336C |
Product Overview : | Recombinant human MCP-2/CCL8(rhMCP-2) produced in E. coli is a single non-glycosylated polypeptide chain containing 76 amino acids. A fully biologically active molecule, rhMCP-2 has a molecular mass of 8.9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 76 |
Description : | MCP-2 is a member of the chemokines, a group of 70-80 residue proteins sharing substantial sequence similarity. Within the chemokines, MCP-2 belongs to the CC subfamily, and is a member of the Monocyte Chemoattractant Proteins (MCPs), which includes MCP-1, MCP-2, MCP-3, MCP-4, and MCP-5. MCP-2 shares 60% homology with MCP-1, and both proteins can undergo reversible dimerization. The main receptors of MCP-2 are G-protein coupled receptors CCR1 and CCR5. MCP-2 is a potential target in HIV-1 infected human glial cells as it may play a role in the modulation of viral spread in the brain. Recently, researchers found that mouse MCP-2 is expressed in the skin as a novel agonist of CCR8 and plays a role in eosinophilic inflammation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 0.5 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL8, corresponding to a specific activity of > 2 × 10^3 units/mg. |
Molecular Mass : | 8.9 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human MCP-2/CCL8(rhMCP-2) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMCP-2 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens ] |
Official Symbol | CCL8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10; |
Gene ID | 6355 |
mRNA Refseq | NM_005623 |
Protein Refseq | NP_005614 |
MIM | 602283 |
UniProt ID | P80075 |
◆ Recombinant Proteins | ||
CCL8-1290H | Recombinant Human CCL8 Protein (Ser29-Pro99), N-His tagged | +Inquiry |
CCL8-304H | Active Recombinant Human Chemokine (C-C Motif) Ligand 8, HIgG1 Fc-tagged | +Inquiry |
CCL8-37H | Recombinant Human CCL8 protein, His-tagged | +Inquiry |
CCL8-692C | Recombinant Cattle CCL8 protein, His & GST-tagged | +Inquiry |
CCL8-45H | Recombinant Human CCL8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *
0
Inquiry Basket