Recombinant Human CCL8 Protein
| Cat.No. : | CCL8-45H |
| Product Overview : | Recombinant Human CCL8 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 76 AA |
| Description : | Monocyte chemotactic protein 2 (MCP-2), also known as CCL8, is a cytokine that is important during allergic and inflammatory responses. MCP-2 activates mast cells, eosinophils, and basophils through the G protein-coupled chemokine receptors CCR1, CCR2B, and CCR5. MCP-2 signaling through the CCR5 receptor also functions as a natural inhibitor of the human immunodeficiency virus, type 1 (HIV-1). |
| Molecular Mass : | Monomer, 8.9 kDa |
| AA Sequence : | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Endotoxin : | ≤ 1 EUs/μg by Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS-PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | At -20 centigrade. |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Handling : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Shipping : | Room temperature. |
| Gene Name | CCL8 C-C motif chemokine ligand 8 [ Homo sapiens (human) ] |
| Official Symbol | CCL8 |
| Synonyms | CCL8; C-C motif chemokine ligand 8; HC14; MCP2; MCP-2; SCYA8; SCYA10; C-C motif chemokine 8; chemokine (C-C motif) ligand 8; monocyte chemoattractant protein 2; monocyte chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); small-inducible cytokine A8 |
| Gene ID | 6355 |
| mRNA Refseq | NM_005623 |
| Protein Refseq | NP_005614 |
| MIM | 602283 |
| UniProt ID | P80075 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *



