Recombinant Human CCL8 Protein

Cat.No. : CCL8-45H
Product Overview : Recombinant Human CCL8 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 76 AA
Description : Monocyte chemotactic protein 2 (MCP-2), also known as CCL8, is a cytokine that is important during allergic and inflammatory responses. MCP-2 activates mast cells, eosinophils, and basophils through the G protein-coupled chemokine receptors CCR1, CCR2B, and CCR5. MCP-2 signaling through the CCR5 receptor also functions as a natural inhibitor of the human immunodeficiency virus, type 1 (HIV-1).
Molecular Mass : Monomer, 8.9 kDa
AA Sequence : QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Endotoxin : ≤ 1 EUs/μg by Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS-PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : At -20 centigrade.
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Handling : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Shipping : Room temperature.
Gene Name CCL8 C-C motif chemokine ligand 8 [ Homo sapiens (human) ]
Official Symbol CCL8
Synonyms CCL8; C-C motif chemokine ligand 8; HC14; MCP2; MCP-2; SCYA8; SCYA10; C-C motif chemokine 8; chemokine (C-C motif) ligand 8; monocyte chemoattractant protein 2; monocyte chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); small-inducible cytokine A8
Gene ID 6355
mRNA Refseq NM_005623
Protein Refseq NP_005614
MIM 602283
UniProt ID P80075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL8 Products

Required fields are marked with *

My Review for All CCL8 Products

Required fields are marked with *

0
cart-icon
0
compare icon