Recombinant Human CD274 Protein, His-Flag-StrepII-Tagged
Cat.No. : | CD274-0763H |
Product Overview : | Purified CD274 (AAH74984.1, 18 a.a. - 238 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 18-238 a.a. |
Description : | This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 29.59 kDa |
AA Sequence : | AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; CD274 antigen, PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296; |
Gene ID | 29126 |
mRNA Refseq | NM_014143 |
Protein Refseq | NP_054862 |
MIM | 605402 |
UniProt ID | Q9NZQ7 |
◆ Recombinant Proteins | ||
CD274-2142HAF647 | Recombinant Human CD274 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd274-821MF | Recombinant Mouse Cd274 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CD274-2330HAF488 | Recombinant Human CD274 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD274-2330HAF555 | Recombinant Human CD274 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd274-561RA | Recombinant Rat Cd274 protein, Fc-tagged, APC labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
0
Inquiry Basket