Recombinant Human CD300c Protein, His-tagged
Cat.No. : | CD300c-011H |
Product Overview : | Recombinant Human CD300c Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD300 molecules comprise a family of receptors that regulate many immune cell processes. Cross-linking of CD300C by its specific antibody caused cytokine/chemokine production of human monocytes and mast cells. specific engagement of CD300C led to Fc receptor γ-dependent activation of mast cells and monocytes. |
Molecular Mass : | ~24 kDa |
AA Sequence : | MGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD300C CD300c molecule [ Homo sapiens (human) ] |
Official Symbol | CD300c |
Synonyms | CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor; CLM-6; CMRF-35; CMRF-35A; CMRF35A1; CMRF35-A1; |
Gene ID | 10871 |
mRNA Refseq | NM_006678 |
Protein Refseq | NP_006669 |
MIM | 606786 |
UniProt ID | Q08708 |
◆ Recombinant Proteins | ||
CD300C-3087M | Active Recombinant mouse CD300C Protein, mIgG2A-tagged | +Inquiry |
CD300C-1695R | Recombinant Rhesus Monkey CD300C Protein | +Inquiry |
CD300C-6886H | Recombinant Human CD300C, His tagged | +Inquiry |
CD300C-7216H | Recombinant Human CD300C, His-tagged | +Inquiry |
CD300C-138H | Recombinant Human CD300C protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD300c Products
Required fields are marked with *
My Review for All CD300c Products
Required fields are marked with *
0
Inquiry Basket