Recombinant Human CHCHD4 Protein (1-142 aa), His-SUMO-tagged
Cat.No. : | CHCHD4-1097H |
Product Overview : | Recombinant Human CHCHD4 Protein (1-142 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transport. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-142 aa |
Description : | Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermbrane space (IMS). Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS. Reduced CHCHD4/MIA40 is then reoxidized by GFER/ERV1 via a disulfide relay syst. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 32.0 kDa |
AA Sequence : | MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CHCHD4 coiled-coil-helix-coiled-coil-helix domain containing 4 [ Homo sapiens ] |
Official Symbol | CHCHD4 |
Synonyms | CHCHD4; FLJ31709; MIA40; TIMM40; |
Gene ID | 131474 |
mRNA Refseq | NM_001098502 |
Protein Refseq | NP_001091972 |
MIM | 611077 |
UniProt ID | Q8N4Q1 |
◆ Recombinant Proteins | ||
CHCHD4-1364R | Recombinant Rat CHCHD4 Protein | +Inquiry |
CHCHD4-3371M | Recombinant Mouse CHCHD4 Protein | +Inquiry |
CHCHD4-3812C | Recombinant Chicken CHCHD4 | +Inquiry |
CHCHD4-34H | Recombinant Human CHCHD4 protein | +Inquiry |
CHCHD4-3314HF | Recombinant Full Length Human CHCHD4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHCHD4-184HCL | Recombinant Human CHCHD4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHCHD4 Products
Required fields are marked with *
My Review for All CHCHD4 Products
Required fields are marked with *
0
Inquiry Basket