Recombinant Human CHCHD4 Protein, GST-Tagged

• Cat.No.: CHCHD4-1209H
• Product Overview: Human CHCHD4 full-length ORF (AAH33775.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 42.4 kDa
• AA Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHCHD4 coiled-coil-helix-coiled-coil-helix domain containing 4 [ Homo sapiens ]
• Official Symbol: CHCHD4
• Synonyms: CHCHD4; coiled-coil-helix-coiled-coil-helix domain containing 4; mitochondrial intermembrane space import and assembly protein 40; FLJ31709; MIA40; mitochondrial intermembrane space import and assembly 40 homolog (S. cerevisiae); TIMM40; translocase of inner mitochondrial membrane 40 homolog (S. cerevisiae); translocase of inner mitochondrial membrane 40 homolog; coiled-coil-helix-coiled-coil-helix domain-containing protein 4; mitochondrial intermembrane space import and assembly 40 homolog
• Gene ID: 131474
• mRNA Refseq: NM_001098502
• Protein Refseq: NP_001091972
• MIM: 611077
• UniProt ID: Q8N4Q1