Recombinant Human CHCHD4 Protein, GST-Tagged

Cat.No. : CHCHD4-1209H
Product Overview : Human CHCHD4 full-length ORF (AAH33775.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008]
Molecular Mass : 42.4 kDa
AA Sequence : MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHCHD4 coiled-coil-helix-coiled-coil-helix domain containing 4 [ Homo sapiens ]
Official Symbol CHCHD4
Synonyms CHCHD4; coiled-coil-helix-coiled-coil-helix domain containing 4; mitochondrial intermembrane space import and assembly protein 40; FLJ31709; MIA40; mitochondrial intermembrane space import and assembly 40 homolog (S. cerevisiae); TIMM40; translocase of inner mitochondrial membrane 40 homolog (S. cerevisiae); translocase of inner mitochondrial membrane 40 homolog; coiled-coil-helix-coiled-coil-helix domain-containing protein 4; mitochondrial intermembrane space import and assembly 40 homolog;
Gene ID 131474
mRNA Refseq NM_001098502
Protein Refseq NP_001091972
MIM 611077
UniProt ID Q8N4Q1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHCHD4 Products

Required fields are marked with *

My Review for All CHCHD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon