Recombinant Human CLDN6 Full Length Transmembrane protein, GFP-tagged

Cat.No. : CLDN6-0193H
Product Overview : Recombinant Human CLDN6 protein(P56747)(1-220aa), fused with C-terminal GFP tag(This tag can be tested only under denaturing conditions), was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP
Protein Length : 1-220aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.5 kDa
AA Sequence : MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CLDN6 claudin 6 [ Homo sapiens ]
Official Symbol CLDN6
Synonyms CLDN6; claudin 6; claudin-6; skullin;
Gene ID 9074
mRNA Refseq NM_021195
Protein Refseq NP_067018
UniProt ID P56747

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN6 Products

Required fields are marked with *

My Review for All CLDN6 Products

Required fields are marked with *

0
cart-icon