Recombinant Human COMMD7, His-tagged
Cat.No. : | COMMD7-27959TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 3-199 of Human COMMD7 with a N terminal His tag; 27kda. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-199 a.a. |
Description : | COMMD is a new family of proteins with homology to MURR1, a multifunctional protein that inhibits NFkB. These proteins form multimeric complexes and were identified in a biochemical screen for MURR1-associated factors. The family is defined by the presence of a conserved and unique motif termed the COMM (copper metabolism gene MURR1) domain, which functions as an interface for protein-protein interactions. The prototype of this family, MURR1/COMMD1, suppresses NFkB by affecting the association of NF-kappaB with chromatin. COMMD7 (COMM domain-containing protein 7) interacts with COMMD1 via its COMM domain. It also associates with the NF-kappa-B complex and suppresses its transcriptional activity. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 122 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RLHCTEDPVPEAVGGDMQQLNQLGAQFSALTEVLFHFLTE PKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNG ALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPT LARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQ LKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSME CFC |
Gene Name | COMMD7 COMM domain containing 7 [ Homo sapiens ] |
Official Symbol | COMMD7 |
Synonyms | COMMD7; COMM domain containing 7; C20orf92, chromosome 20 open reading frame 92; COMM domain-containing protein 7; dJ1085F17.3; |
Gene ID | 149951 |
mRNA Refseq | NM_001099339 |
Protein Refseq | NP_001092809 |
Uniprot ID | Q86VX2 |
Chromosome Location | 20q11 |
Function | NF-kappaB binding; protein binding; |
◆ Recombinant Proteins | ||
Commd7-2252M | Recombinant Mouse Commd7 Protein, Myc/DDK-tagged | +Inquiry |
COMMD7-27959TH | Recombinant Human COMMD7, His-tagged | +Inquiry |
COMMD7-6324H | Recombinant Human COMMD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COMMD7-1684H | Recombinant Human COMMD7 Protein, GST-tagged | +Inquiry |
COMMD7-5295C | Recombinant Chicken COMMD7 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD7 Products
Required fields are marked with *
My Review for All COMMD7 Products
Required fields are marked with *
0
Inquiry Basket