Recombinant Human CST4
Cat.No. : | CST4-27162TH |
Product Overview : | Recombinant full length Human Cystatin S with N terminal proprietary tag; Predicted MWt 41.58 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 141 amino acids |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function. |
Molecular Weight : | 41.580kDa inclusive of tags |
Tissue specificity : | Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLN DEWVQRALHFAISEYNKATEDEYYRRPLQVLRAREQTFGG VNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF EIYEVPWEDRMSLVNSRCQEA |
Sequence Similarities : | Belongs to the cystatin family. |
Gene Name | CST4 cystatin S [ Homo sapiens ] |
Official Symbol | CST4 |
Synonyms | CST4; cystatin S; cystatin-S; |
Gene ID | 1472 |
mRNA Refseq | NM_001899 |
Protein Refseq | NP_001890 |
MIM | 123857 |
Uniprot ID | P01036 |
Chromosome Location | 20p11.2 |
Pathway | Salivary secretion, organism-specific biosystem; Salivary secretion, conserved biosystem; |
Function | cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity; |
◆ Recombinant Proteins | ||
CYSS-0214B | Recombinant Bacillus subtilis CYSS protein, His-tagged | +Inquiry |
CYSS-1762R | Recombinant Rat CYSS Protein | +Inquiry |
CYSS-3673S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 CYSS protein, His-tagged | +Inquiry |
CST4-97HF | Recombinant Full Length Human CST4 Protein | +Inquiry |
CST4-1851H | Recombinant Human CST4 Protein (Ser21-Ala141), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST4-2241HCL | Recombinant Human CST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST4 Products
Required fields are marked with *
My Review for All CST4 Products
Required fields are marked with *
0
Inquiry Basket